PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00110589001
Common NameGSBRNA2T00110589001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 143aa    MW: 17219.1 Da    PI: 11.3919
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00110589001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.63.2e-291568255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrW+++LH+ Fv +v++LGG+ kAtPk+i+++m+vk+Ltl+hvkSHLQ+YR 
  GSBRNA2T00110589001 15 PRLRWATDLHQYFVYVVNRLGGERKATPKKIVQAMGVKSLTLSHVKSHLQMYRN 68
                         8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-271171IPR009057Homeodomain-like
SuperFamilySSF466894.12E-141371IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-221570IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MEKPIVRFYT KSKMPRLRWA TDLHQYFVYV VNRLGGERKA TPKKIVQAMG VKSLTLSHVK  60
SHLQMYRNKK RRDSVQAERR MRREMRWRQS QQHLQIYERL RDAIEFMQNQ RRLSDNKEKT  120
IEFLKPSNKA MEVSCKSLFQ SS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00110589001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628412.12e-95PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A078EMR91e-103A0A078EMR9_BRANA; BnaC03g37170D protein
STRINGBra029503.1-P2e-86(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04580.17e-41G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]